Iright
BRAND / VENDOR: Proteintech

Proteintech, 27563-1-AP, CD64 Polyclonal antibody

CATALOG NUMBER: 27563-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD64 (27563-1-AP) by Proteintech is a Polyclonal antibody targeting CD64 in WB, IF/ICC, ELISA applications with reactivity to human samples 27563-1-AP targets CD64 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Fcγ receptor comprise a multigene family of integral membrane glycoproteins that exhibit complex activation or inhibitory effects on cell functions after aggregation by complexed immunoglobulin G (IgG) (PMID: 17005690 ). CD64, also known as FcγRIA, is a high affinity receptor for the Fc region of IgG. It is expressed by monocytes/macrophages, activated neutrophils, dendritic cells, and early myeloid cells (PMID: 23293080; 19642859; 7680917). CD64 functions in both innate and adaptive immune responses. The calculated molecular weight of CD64 is 43 kDa, while the glycosylated CD64 has a higher apparent molecular weight. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26727 Product name: Recombinant human FCGR1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-374 aa of BC032634 Sequence: VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT Predict reactive species Full Name: Fc fragment of IgG, high affinity Ia, receptor (CD64) Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 65-70 kDa, 43-45 kDa GenBank Accession Number: BC032634 Gene Symbol: FCGR1A Gene ID (NCBI): 2209 ENSEMBL Gene ID: ENSG00000150337 RRID: AB_2880909 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12314 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924