Iright
BRAND / VENDOR: Proteintech

Proteintech, 27566-1-AP, TAB1 Polyclonal antibody

CATALOG NUMBER: 27566-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TAB1 (27566-1-AP) by Proteintech is a Polyclonal antibody targeting TAB1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27566-1-AP targets TAB1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, HEK-293T cells, NIH/3T3 cells, HCT 116 cells, HeLa cells, K-562 cells Positive IHC detected in: human colon cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (TAB1) is also named TAK1-binding protein 1 and MAP3K7IP1. TAB1 is constitutively associated with the composition N-terminal kinase domain of TAK1 and can be activated by pro-inflammatory cytokines (TNFα and IL-1β) and toll-like receptor ligands (PMID: 38072991). TAB1 is a scaffolding protein required for TGF-β activated kinase-1 (TAK1) mediated signalling. TAB1 is a specific protein that interacts with transforming growth factor β-activated kinase 1 (TAK1) (PMID: 32676538). TAB1/TAK1 can activate nuclear factor κB (NF-κB) in high glucose (HG)-induced BMMs, regulating macrophage activation (PMID: 32296020, PMID: 23851980). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25576 Product name: Recombinant human MAP3K7IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-504 aa of BC050554 Sequence: TSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase 7 interacting protein 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC050554 Gene Symbol: TAB1 Gene ID (NCBI): 10454 RRID: AB_2880910 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15750 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924