Proteintech, 27568-1-AP, ANKRD46 Polyclonal antibody

Size: 20ul / 150ul The ANKRD46 (27568-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD46 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27568-1-AP targets ANKRD46 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ANKRD46 encodes a protein containing multiple ankyrin repeats. Ankyrin domains function in protein-protein interactions in a variety of cellular processes. ANKRD46 also known as ankyrin repeat small protein (ANK-S), is a 228-amino acid single-pass membrane protein(PMID: 21219636). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26623 Product name: Recombinant human ANKRD46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC060843 Sequence: MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED Predict reactive species Full Name: ankyrin repeat domain 46 Observed Molecular Weight: 25 kDa GenBank Accession Number: BC060843 Gene Symbol: ANKRD46 Gene ID (NCBI): 157567 RRID: AB_3669610 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86W74 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.