Iright
BRAND / VENDOR: Proteintech

Proteintech, 27585-1-AP, TMEM119 Polyclonal antibody

CATALOG NUMBER: 27585-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM119 (27585-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM119 in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples 27585-1-AP targets TMEM119 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue, mouse liver tissue Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26269 Product name: Recombinant human TMEM119 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species Full Name: transmembrane protein 119 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_181724 Gene Symbol: TMEM119 Gene ID (NCBI): 338773 RRID: AB_2880915 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4V9L6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924