Iright
BRAND / VENDOR: Proteintech

Proteintech, 27586-1-AP, TERT Polyclonal antibody

CATALOG NUMBER: 27586-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TERT (27586-1-AP) by Proteintech is a Polyclonal antibody targeting TERT in WB, ELISA applications with reactivity to human, mouse, rat samples 27586-1-AP targets TERT in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Telomerase reverse transcriptase (TERT) is a catalytic subunit of telomerase. TERT plays a key role in cancer formation, ensuring chromosomal stability by maintaining telomere length, and allowing cells to avert senescence. It constitutes a limiting factor for formation of the telomerase complex in cancer cells. TERT is one of two major components of the larger telomerase complex, which extends telomeres by adding specific short repetitive DNA sequences. Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. The calculated MW of TERT is 127 kDa, 27586-1-AP can detect a band around 100 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26270 Product name: Recombinant human TERT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 219-320 aa of NM_001193376 Sequence: MPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTP Predict reactive species Full Name: telomerase reverse transcriptase Calculated Molecular Weight: 127 kDa Observed Molecular Weight: ~100 kDa GenBank Accession Number: NM_001193376 Gene Symbol: TERT Gene ID (NCBI): 7015 RRID: AB_3085971 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924