Proteintech, 27591-1-AP, SLC24A3 Polyclonal antibody

Size: 20ul / 150ul The SLC24A3 (27591-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A3 in WB, ELISA applications with reactivity to human, mouse, rat samples 27591-1-AP targets SLC24A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC24A3, also known as NCKX3 (Na⁺/K⁺/Ca²⁺ exchanger 3), is a member of the solute carrier family 24 (SLC24), which comprises five K⁺-dependent Na⁺/Ca²⁺ exchangers (NCKX1-5). These transporters are critical for maintaining intracellular calcium homeostasis by coupling the extrusion of one Ca²⁺ ion and one K⁺ ion to the influx of four Na⁺ ions. SLC24A3 plays a key role in calcium signaling and homeostasis, influencing processes such as neurotransmission, smooth muscle contraction, and female reproductive physiology. Relatively high levels of SLC24A3 expression can be observed in heart tissue, consistent with the expression patterns reported in the literature. The observed molecular weight of SLC24A3 is 50-60 kDa, which is consistent with the literature description. (PMID: 21573014, PMID: 28588505) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26297 Product name: Recombinant human SLC24A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-450 aa of NM_020689 Sequence: MSRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKW Predict reactive species Full Name: solute carrier family 24 (sodium/potassium/calcium exchanger), member 3 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: NM_020689 Gene Symbol: SLC24A3 Gene ID (NCBI): 57419 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC58 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.