Iright
BRAND / VENDOR: Proteintech

Proteintech, 27600-1-AP, CIDEB Polyclonal antibody

CATALOG NUMBER: 27600-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CIDEB (27600-1-AP) by Proteintech is a Polyclonal antibody targeting CIDEB in WB, IHC, ELISA applications with reactivity to Human, mouse samples 27600-1-AP targets CIDEB in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Cell death‐inducing DFFA‐like effector B (CIDEB), an ER and lipid droplet (LD)‐associated protein primarily expressed in the liver, participated in lipid metabolism by regulating lipid droplet fusion and VLDL lipidation. Although CIDEA is expressed at high levels in brown adipose tissue (BAT) and CIDEC is highly enriched in white adipose tissue (WAT) and BAT, CIDEB is more abundant in liver, kidney, small intestine, and colon. CIDEB is localized to endoplasmic reticulum and lipid droplets. (PMID: 30858281, PMID: 24831470, PMID: 19187774) Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27003 Product name: Recombinant human CIDEB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-179 aa of BC035970 Sequence: RVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELL Predict reactive species Full Name: cell death-inducing DFFA-like effector b Calculated Molecular Weight: 219 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC035970 Gene Symbol: CIDEB Gene ID (NCBI): 27141 RRID: AB_2880922 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924