Proteintech, 27608-1-AP, SIK2 Polyclonal antibody

Size: 20ul / 150ul The SIK2 (27608-1-AP) by Proteintech is a Polyclonal antibody targeting SIK2 in WB, IHC, ELISA applications with reactivity to human samples 27608-1-AP targets SIK2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, U2OS cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26468 Product name: Recombinant human SIK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 617-926 aa of BC113459 Sequence: VQLLYEQIGPEADPNLAPAAPQLQDLASSCPQEEVSQQQESVSTLPASVHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSLTQPLSPVLEPSSEQMQYSPFLSQYQEMQLQPLPSTSGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPAPLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCEMLDAVDPQHNGYVLVN Predict reactive species Full Name: salt-inducible kinase 2 Calculated Molecular Weight: 926 aa, 104 kDa Observed Molecular Weight: 103-110 kDa GenBank Accession Number: BC113459 Gene Symbol: SIK2 Gene ID (NCBI): 23235 RRID: AB_3669614 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0K1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.