Iright
BRAND / VENDOR: Proteintech

Proteintech, 27616-1-AP, FPGS Polyclonal antibody

CATALOG NUMBER: 27616-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FPGS (27616-1-AP) by Proteintech is a Polyclonal antibody targeting FPGS in WB, IHC, ELISA applications with reactivity to human, mouse samples 27616-1-AP targets FPGS in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa mitochondrial extract Positive IHC detected in: mouse kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FPGS is located in the cytosol and mitochondria of mammalian tissues, with current evidence supporting a single gene encoding for both the cytosolic and mitochondrial isoenzymes. FPGS catalyzes a rate-limiting polyglutamylation step in the folic acid metabolic pathway and increases the intracellular retention of folates (PMID: 8907263, PMID: 31611592). FPGS has 4 isoforms with the molecular mass of 59-65 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24775 Product name: Recombinant human FPGS protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 397-587 aa of BC064393 Sequence: QGRERPSGGPEVRVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSVPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ Predict reactive species Full Name: folylpolyglutamate synthase Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC064393 Gene Symbol: FPGS Gene ID (NCBI): 2356 RRID: AB_3669615 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05932 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924