Proteintech, 27618-1-AP, TMC2 Polyclonal antibody

Size: 20ul / 150ul The TMC2 (27618-1-AP) by Proteintech is a Polyclonal antibody targeting TMC2 in IHC, ELISA applications with reactivity to Human, mouse samples 27618-1-AP targets TMC2 in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26366 Product name: Recombinant human TMC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 805-906 aa of NM_080751 Sequence: MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH Predict reactive species Full Name: transmembrane channel-like 2 Calculated Molecular Weight: 103 kDa GenBank Accession Number: NM_080751 Gene Symbol: TMC2 Gene ID (NCBI): 117532 RRID: AB_3085977 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDI7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.