Proteintech, 27633-1-AP, CHAF1B Polyclonal antibody

Size: 20ul / 150ul The CHAF1B (27633-1-AP) by Proteintech is a Polyclonal antibody targeting CHAF1B in WB, IHC, ELISA applications with reactivity to human samples 27633-1-AP targets CHAF1B in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, HeLa cells, HepG2 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CHAF1B, also named as CAF1A, CAF1P60, MPHOSPH7, MPP7, is a 559 amino acid protein, which belongs to the WD repeat HIR1 family. CHAF1B as a subunit of the CAF-1 complex that contains RBBP4, CHAF1B and CHAF1A. CHAF1B is thought to mediate chromatin assembly in DNA replication and DNA repair and assembles histone octamers onto replicating DNA in vitro. The calcualted molecular weight of CHAF1B is 61 kDa, but molecular weight of CHAF1B is detected about 65-70 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26504 Product name: Recombinant human CHAF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-559 aa of BC021218 Sequence: TFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTPASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP Predict reactive species Full Name: chromatin assembly factor 1, subunit B (p60) Calculated Molecular Weight: 559 aa, 61 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC021218 Gene Symbol: CHAF1B Gene ID (NCBI): 8208 RRID: AB_2880933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13112 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.