Iright
BRAND / VENDOR: Proteintech

Proteintech, 27635-1-AP, BACH2 Polyclonal antibody

CATALOG NUMBER: 27635-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BACH2 (27635-1-AP) by Proteintech is a Polyclonal antibody targeting BACH2 in WB, ELISA applications with reactivity to Human samples 27635-1-AP targets BACH2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Daudi cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information BACH2, also named as Transcription regulator protein BACH2, is a 841 amino acid protein, which is widely expressed within the B-lymphoid lineage, except in plasma cells. BACH2 contains an N-terminal BTB domain involved in its transcriptional function, but instead of having zinc fingers at the C-terminus, it binds to DNA through a basic leucine zipper motif. BACH2 binds DNA consensus sequences, termed MARE motifs, by forming a heterodimer with small leucine zipper MAF proteins such as MAFK, MAFG, and MAFF. The calculated molecular weight of BACH2 is 92 kDa, but the post-modifiction of BACH2 is about 120-130 kDa. (PMID: 24277074 ) Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26526 Product name: Recombinant human BACH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-235 aa of NM_001170794 Sequence: MSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQ Predict reactive species Full Name: BTB and CNC homology 1, basic leucine zipper transcription factor 2 Calculated Molecular Weight: 93 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: NM_001170794 Gene Symbol: BACH2 Gene ID (NCBI): 60468 RRID: AB_2880934 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924