Iright
BRAND / VENDOR: Proteintech

Proteintech, 27646-1-AP, TXNL4A Polyclonal antibody

CATALOG NUMBER: 27646-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TXNL4A (27646-1-AP) by Proteintech is a Polyclonal antibody targeting TXNL4A in WB, IF/ICC, ELISA applications with reactivity to Human samples 27646-1-AP targets TXNL4A in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells, L02 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26473 Product name: Recombinant human TXNL4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC001046 Sequence: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY Predict reactive species Full Name: thioredoxin-like 4A Calculated Molecular Weight: 142 aa, 17 kDa Observed Molecular Weight: 14-20 kDa GenBank Accession Number: BC001046 Gene Symbol: TXNL4A Gene ID (NCBI): 10907 RRID: AB_2880937 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P83876 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924