Proteintech, 27648-1-AP, TPD52 Polyclonal antibody

Size: 20ul / 150ul The TPD52 (27648-1-AP) by Proteintech is a Polyclonal antibody targeting TPD52 in WB, IHC, ELISA applications with reactivity to Human samples 27648-1-AP targets TPD52 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: L02 cells, HepG2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26503 Product name: Recombinant human TPD52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 57-184 aa of BC018117 Sequence: LAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL Predict reactive species Full Name: tumor protein D52 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 23-27 kDa GenBank Accession Number: BC018117 Gene Symbol: TPD52 Gene ID (NCBI): 7163 RRID: AB_3085979 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55327 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.