Proteintech, 27650-1-AP, HIF3A Polyclonal antibody

Size: 20ul / 150ul The HIF3A (27650-1-AP) by Proteintech is a Polyclonal antibody targeting HIF3A in WB, IF/ICC, ELISA applications with reactivity to human samples 27650-1-AP targets HIF3A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Cobalt Chloride treated HeLa cells, A431 cells Positive IF/ICC detected in: Tunicamycin treated HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HIF3A, Hypoxia-inducible factor 3-alpha, acts as a transcriptional regulator in adaptive response to low oxygen tension (PMID:11573933, PMID:16126907, PMID:19694616, PMID:20416395, PMID:21069422). It functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. HIF3A also plays a role in the development of the cardiorespiratory system. HIF3A was up-regulated by hypoxia (PMID:16775626). Multiple alternatively spliced transcript variants have been found. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26574 Product name: Recombinant human HIF3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 401-486 aa of NM_022462 Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD Predict reactive species Full Name: hypoxia inducible factor 3, alpha subunit Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: NM_022462 Gene Symbol: HIF3A Gene ID (NCBI): 64344 RRID: AB_2880939 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.