Iright
BRAND / VENDOR: Proteintech

Proteintech, 27666-1-AP, EPG5 Polyclonal antibody

CATALOG NUMBER: 27666-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EPG5 (27666-1-AP) by Proteintech is a Polyclonal antibody targeting EPG5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27666-1-AP targets EPG5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information EPG5, a metazoan-specific autophagy protein, regulates autophagy by promoting fusion of autophagosomes with lysosomes and/or late endosomes. EPG5 regulates the stability and the assembly of STX17-SNAP29-VAMP8 trans-SNARE complexes. Loss of function of EPG5 causes non-specific fusion of autophagosomes with other endocytic vesicles, resulting in formation of non-degradative enlarged vesicles. EPG5 expression in human pluripotent stem cells like ESC and iPSC is higher than that of human somatic cells.(PMID: 30931944, PMID: 27588602) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24801 Product name: Recombinant human KIAA1632 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2112-2462 aa of BC130614 Sequence: ETRSMIVCLLFMMILLAKEVQLVDQTDSPLLSLLGQTSSLSWHLVDIVSYQSVLSYFSSHYPPSIILAKESYAELIMKLLKVSAGLSIPTDSQKHLDAVPKCQAFTHQMVQFLSTLEQNGKITLAVLEQEMSKLLDDIIVFNPPDMDSQTRHMALSSLFMEVLMMMNNATIPTAEFLRGSIRTWIGQKMHGLVVLPLLTAACQSLASVRHMAETTEACITAYFKESPLNQNSGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLRNEMKVLLILSKWLEQVYPSSVEEEAKLFLWWHQVLQLSLIQTEQNDSVLTESVIRILLLVQSRQNLVAEERL Predict reactive species Full Name: KIAA1632 Calculated Molecular Weight: 2579 aa, 292 kDa Observed Molecular Weight: 270-290 kDa GenBank Accession Number: BC130614 Gene Symbol: EPG5 Gene ID (NCBI): 57724 RRID: AB_3085981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCE0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924