Proteintech, 27674-1-AP, A2ML1 Polyclonal antibody

Size: 20ul / 150ul The A2ML1 (27674-1-AP) by Proteintech is a Polyclonal antibody targeting A2ML1 in WB, ELISA applications with reactivity to Human samples 27674-1-AP targets A2ML1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human saliva Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information A2ML1 is a member of the alpha-macroglobulin superfamily. It is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25818 Product name: Recombinant human A2ML1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1375-1454 aa of BC112131 Sequence: FSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE Predict reactive species Full Name: alpha-2-macroglobulin-like 1 Calculated Molecular Weight: 1454 aa, 161 kDa Observed Molecular Weight: 161 kDa GenBank Accession Number: BC112131 Gene Symbol: A2ML1 Gene ID (NCBI): 144568 RRID: AB_3085984 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A8K2U0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.