Product Description
Size: 20ul / 150ul
The AGAP3 (27681-1-AP) by Proteintech is a Polyclonal antibody targeting AGAP3 in WB, ELISA applications with reactivity to human samples
27681-1-AP targets AGAP3 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells, L02 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Background Information
AGAP3, also known as MRIP-1, CENTG3, contains multiple signaling domains, a GTPase-like domain, a pleckstrin homology domain, and an ArfGAP domain, and exists as a component of the NMDA receptor complex. AGAP3 is a component of the NMDA receptor complex that regulates Arf6 and Ras/ERK signaling (PMID: 23904596).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26662 Product name: Recombinant human AGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 474-556 aa of BC044644 Sequence: LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT Predict reactive species
Full Name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
Calculated Molecular Weight: 95 kDa
Observed Molecular Weight: 95 kDa
GenBank Accession Number: BC044644
Gene Symbol: AGAP3
Gene ID (NCBI): 116988
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96P47
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924