Proteintech, 27681-1-AP, AGAP3 Polyclonal antibody

Size: 20ul / 150ul The AGAP3 (27681-1-AP) by Proteintech is a Polyclonal antibody targeting AGAP3 in WB, ELISA applications with reactivity to human samples 27681-1-AP targets AGAP3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information AGAP3, also known as MRIP-1, CENTG3, contains multiple signaling domains, a GTPase-like domain, a pleckstrin homology domain, and an ArfGAP domain, and exists as a component of the NMDA receptor complex. AGAP3 is a component of the NMDA receptor complex that regulates Arf6 and Ras/ERK signaling (PMID: 23904596). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26662 Product name: Recombinant human AGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 474-556 aa of BC044644 Sequence: LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT Predict reactive species Full Name: ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 Calculated Molecular Weight: 95 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC044644 Gene Symbol: AGAP3 Gene ID (NCBI): 116988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96P47 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.