Proteintech, 27682-1-AP, EGR4 Polyclonal antibody

Size: 20ul / 150ul The EGR4 (27682-1-AP) by Proteintech is a Polyclonal antibody targeting EGR4 in WB, ELISA applications with reactivity to human, mouse, rat samples 27682-1-AP targets EGR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-231 cells, PC-12 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EGR4 is a member of the Early Growth Response (EGR) family of transcription factors, which also includes EGR1, EGR2, and EGR3. These proteins are characterized by their rapid and transient induction in response to a wide array of extracellular signals. EGR4 functions as a sequence-specific DNA-binding protein that regulates the expression of target genes involved in critical biological processes, most notably in the nervous and immune systems. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26687 Product name: Recombinant human EGR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-140 aa of NM_001965 Sequence: MPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA Predict reactive species Full Name: early growth response 4 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: NM_001965 Gene Symbol: EGR4 Gene ID (NCBI): 1961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05215 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.