Proteintech, 27688-1-AP, TP73 Polyclonal antibody

Size: 20ul / 150ul The TP73 (27688-1-AP) by Proteintech is a Polyclonal antibody targeting TP73 in WB, IHC, ELISA applications with reactivity to human samples 27688-1-AP targets TP73 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, human placenta tissue Positive IHC detected in: human skin cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TP73 is a member of the TP53 family whose expression has been observed altered in most human cancers and associated with the prognosis. TP73 translates into a complex number of isoforms with both oncogenic and tumor-suppressor functions and presents a complex cross-talk with other members of the family (TP53 and TP63). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26686 Product name: Recombinant human TP73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001126240 Sequence: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA Predict reactive species Full Name: tumor protein p73 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001126240 Gene Symbol: TP73 Gene ID (NCBI): 7161 RRID: AB_3669616 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15350 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.