Proteintech, 27706-1-AP, RREB1 Polyclonal antibody

Size: 20ul / 150ul The RREB1 (27706-1-AP) by Proteintech is a Polyclonal antibody targeting RREB1 in WB, IHC, ELISA applications with reactivity to human samples 27706-1-AP targets RREB1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, LNCaP cells Positive IHC detected in: human colon cancer tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information RREB1, also named as FINB and Zep-1, belongs to the krueppel C2H2-type zinc-finger protein family.RREB1 is a transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. RREB1 may be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression. RREB1 represses the angiotensinogen gene. RREB1 can induce expression of p53 and represse p16 which associated with the expression of tumour. It has been reported that the RREB1 can be a candidate gene for type 2 diabetes associated end-stage kidney disease. To some extent, the decrease of zinc in human pancreatic adenocarcinoma is associated with the downregulation of RREB1. RREB1 has some isoforms with 250 kDa, 180-200 kDa and 140-160 kDa protein.(PMID: 21703425, 15067362, 25050557, 25027322) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26780 Product name: Recombinant human RREB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1324-1514 aa of NM_001003698 Sequence: MREEHGRGESHEPEEEHGTEESTGDADGAEEDASSNQSLDLDFATKLMDFKLAEGDGEAGAGGAASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQEPKDEKGDGASTAEEGPQPAPEQEEKPPETPAEVVESAPGAGEAPAEKLAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSPKSVASKADKRKKVC Predict reactive species Full Name: ras responsive element binding protein 1 Calculated Molecular Weight: 181 kDa Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_001003698 Gene Symbol: RREB1 Gene ID (NCBI): 6239 RRID: AB_2880948 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92766 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.