Iright
BRAND / VENDOR: Proteintech

Proteintech, 27718-1-AP, PRDM2 Polyclonal antibody

CATALOG NUMBER: 27718-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PRDM2 (27718-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM2 in WB, ELISA applications with reactivity to Human samples 27718-1-AP targets PRDM2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information PRDM2, also named as KMT8, RIZ, is a 1718 amino acid protein, which belongs to the class V-like SAM-binding methyltransferase superfamily. PRDM2 localizes in the nucleus and is highly expressed in retinoblastoma cell lines and in brain tumors and is also expressed in a number of other cell lines and in brain, heart, skeletal muscle, liver and spleen. Isoform 1 is expressed in testis at much higher level than isoform 3. PRDM2 as a S-adenosyl-L-methionine-dependent histone methyltransferase that specifically methylates 'Lys-9' of histone H3. May function as a DNA-binding transcription factor. The calculated molecular weight of PRDM2 is about 189 kDa. PRDM2 exists some isoforms with 250 kDa and 280 kDa. (PMID: 26040698) Specification Tested Reactivity: Human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26769 Product name: Recombinant human PRDM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-264 aa of NM_001007257 Sequence: MGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVN Predict reactive species Full Name: PR domain containing 2, with ZNF domain Calculated Molecular Weight: 189 kDa Observed Molecular Weight: 250-280 kDa GenBank Accession Number: NM_001007257 Gene Symbol: PRDM2 Gene ID (NCBI): 7799 RRID: AB_2880951 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13029 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924