Proteintech, 27720-1-AP, SLC25A42 Polyclonal antibody

Size: 20ul / 150ul The SLC25A42 (27720-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A42 in WB, ELISA applications with reactivity to human, mouse samples 27720-1-AP targets SLC25A42 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse adipose tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC25A42 is a member of the SLC25 family of mitochondrial solute carriers. It is involved in the transport of crucial metabolic intermediates across the inner mitochondrial membrane, facilitating energy production and cellular metabolism. The gene encoding SLC25A42 is located on the human chromosome and expresses a protein that acts as a transporter in the mitochondria, aiding in the efficient exchange of molecules between the cytoplasm and the mitochondrial matrix. This protein has a calculated molecular weight of 30-35 kDa.This transporter may play a role in various physiological processes, potentially influencing mitochondrial function and overall cellular health (PMID: 40246810). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26313 Product name: Recombinant human SLC25A42 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC045598 Sequence: MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRV Predict reactive species Full Name: solute carrier family 25, member 42 Calculated Molecular Weight: 318 aa, 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC045598 Gene Symbol: SLC25A42 Gene ID (NCBI): 284439 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.