Iright
BRAND / VENDOR: Proteintech

Proteintech, 27740-1-AP, Histone H2B Polyclonal antibody

CATALOG NUMBER: 27740-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Histone H2B (27740-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2B in WB, IF/ICC, ChIP, ELISA applications with reactivity to human samples 27740-1-AP targets Histone H2B in WB, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293T cells, HEK-293 cells Positive IF/ICC detected in: HEK-293 cells Positive ChIP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Chromatin immunoprecipitation (ChIP): CHIP : 1:10-1:100 Background Information Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. HIST3H2BB is a replication-dependent histone that is a member of the histone H2B family. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26901 Product name: Recombinant human HIST3H2BB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC100855 Sequence: MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species Full Name: histone cluster 3, H2bb Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC100855 Gene Symbol: Histone H2B Gene ID (NCBI): 128312 RRID: AB_3085992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924