Iright
BRAND / VENDOR: Proteintech

Proteintech, 27741-1-AP, TRAFD1 Polyclonal antibody

CATALOG NUMBER: 27741-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRAFD1 (27741-1-AP) by Proteintech is a Polyclonal antibody targeting TRAFD1 in WB, IHC, IP, ELISA applications with reactivity to human samples 27741-1-AP targets TRAFD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, A549 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human tonsillitis tissue, human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TRAFD1, also known as TRAF-type zinc finger domain containing 1, is a protein that plays a significant role in immune system signaling pathways. It was first identified as an interferon- (IFN) and lipopolysaccharide- (LPS) inducible factor. TRAFD1 contains a TRAF-type zinc finger domain at its N-terminus and a TRAF6-binding motif in its middle region, which allows it to interact with other TRAF proteins and modulate immune responses. In the context of immune signaling, TRAFD1 has been shown to suppress the inflammatory responses to innate immunity by inhibiting Toll-like receptor 4 (TLR4) dependent NF-κB and MAPK activation in monocytes/macrophages. This suggests that TRAFD1 can act as a negative regulator of immune signaling, dampening the inflammatory response. Moreover, TRAFD1 has been implicated in human diseases. It is overexpressed in many B cell-related cancers, and single nucleotide polymorphisms (SNPs) in TRAFD1 have been linked to non-Hodgkin's lymphoma. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26945 Product name: Recombinant human TRAFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-335 aa of BC003553 Sequence: HEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPD Predict reactive species Full Name: TRAF-type zinc finger domain containing 1 Calculated Molecular Weight: 582 aa, 65 kDa Observed Molecular Weight: 65-80 kDa GenBank Accession Number: BC003553 Gene Symbol: TRAFD1 Gene ID (NCBI): 10906 RRID: AB_2880958 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14545 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924