Proteintech, 27742-1-AP, ASAH2 Polyclonal antibody

Size: 20ul / 150ul The ASAH2 (27742-1-AP) by Proteintech is a Polyclonal antibody targeting ASAH2 in WB, ELISA applications with reactivity to Human, mouse samples 27742-1-AP targets ASAH2 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26908 Product name: Recombinant human ASAH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-333 aa of BC107105 Sequence: GVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKG Predict reactive species Full Name: N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2 Calculated Molecular Weight: 780 aa, 86 kDa Observed Molecular Weight: 100-115 kDa GenBank Accession Number: BC107105 Gene Symbol: ASAH2 Gene ID (NCBI): 56624 RRID: AB_2918129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.