Proteintech, 27749-1-AP, Syndetin/CCDC132 Polyclonal antibody

Size: 20ul / 150ul The Syndetin/CCDC132 (27749-1-AP) by Proteintech is a Polyclonal antibody targeting Syndetin/CCDC132 in WB, IP, ELISA applications with reactivity to Human, mouse, rat samples 27749-1-AP targets Syndetin/CCDC132 in WB, IP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26944 Product name: Recombinant human CCDC132 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 337-593 aa of BC152424 Sequence: EWHEKHDNEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLN Predict reactive species Full Name: coiled-coil domain containing 132 Calculated Molecular Weight: 964 aa, 111 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC152424 Gene Symbol: Syndetin/CCDC132 Gene ID (NCBI): 55610 RRID: AB_2880961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.