Proteintech, 27754-1-AP, DDIAS Polyclonal antibody

Size: 20ul / 150ul The DDIAS (27754-1-AP) by Proteintech is a Polyclonal antibody targeting DDIAS in WB, ELISA applications with reactivity to human samples 27754-1-AP targets DDIAS in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DNA damage-induced apoptosis suppressor (DDIAS) is an oncogenic protein that is highly expressed in several cancers, including colorectal, lung, breast, and hepatocellular carcinoma (HCC), and stimulates cancer cell proliferation and cell cycle progression.DDIAS protects cancer cells from DNA damage reagents and tumor necrosis factor-associated apoptosis-inducing ligands (TRAILs) and positively regulates cancer cell invasion by stabilizing the β- catenin positively regulates cancer cell invasion. Therefore, DDIAS is considered as a potential therapeutic target for malignant lung cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26829 Product name: Recombinant human C11orf82 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-170 aa of BC039268 Sequence: IYPSCQKCFSRIILVSKRSNCPKCGSTGESGNANYRYKLSLKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQPGQGSDASNFLQQCSDHKRKAKALVACQIVLPDP Predict reactive species Full Name: chromosome 11 open reading frame 82 Observed Molecular Weight: 120 kDa GenBank Accession Number: BC039268 Gene Symbol: C11orf82 Gene ID (NCBI): 220042 RRID: AB_3669620 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.