Proteintech, 27755-1-AP, HOGA1 Polyclonal antibody

Size: 20ul / 150ul The HOGA1 (27755-1-AP) by Proteintech is a Polyclonal antibody targeting HOGA1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 27755-1-AP targets HOGA1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information HOGA1 (4-hydroxy-2-oxoglutarate aldolase), also known as C10orf65, DHDPSL, is a mitochondrial enzyme that plays a gatekeeper role in hydroxyproline metabolis. HOGA1 is primarily expressed in liver and kidney and catalyzes the final step of mitochondrial hydroxyproline metabolism\ from 4-hydroxy-2-oxoglutarate to glyoxylate and pyruvate (PMID: 31696211). Identification of mutations in the HOGA1 gene as the cause of autosomal recessive primary hyperoxaluria (PH) type III has revitalized research in the field of PH and related stone disease (PMID: 22781098). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26849 Product name: Recombinant human C10orf65 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-327 aa of BC045550 Sequence: VVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSSAALIHHYTKVADLSPIPVVLYSVPANTGLDLPVDAVVTLSQHPNIVGMKDSGGDVTRIGLIVHKTRKQDFQVLAGSAGFLMASYALGAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEPNAAVTRRFGIPGLKKIMDWFGYYGGPCRAPLQELSPAEEEALRMDFTSNGWL Predict reactive species Full Name: chromosome 10 open reading frame 65 Observed Molecular Weight: 35 kDa GenBank Accession Number: BC045550 Gene Symbol: HOGA1 Gene ID (NCBI): 112817 RRID: AB_3669621 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.