Product Description
Size: 20ul / 150ul
The TMCO1 (27757-1-AP) by Proteintech is a Polyclonal antibody targeting TMCO1 in WB, IHC, ELISA applications with reactivity to human samples
27757-1-AP targets TMCO1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, L02 cells
Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
TMCO1, also known as TMCC4, PNAS-10, and PNAS-136, is a 188 amino acid protein, which is Widely expressed in adult and fetal tissues, with higher levels in thymus, prostate, testis and small intestine and lower levels in brain, placenta, lung and kidney (PubMed:10393320, PubMed:20018682). TMCO1 as a Calcium-selective channel is required to prevent calcium stores from overfilling, thereby playing a key role in calcium homeostasis (PubMed:27212239). In response to endoplasmic reticulum overloading, TMCO1, assembles into a homotetramer, forming a functional calcium-selective channel, regulating the calcium content in endoplasmic reticulum store (PubMed:27212239).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26278 Product name: Recombinant human TMCO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-188 aa of NM_019026 Sequence: MGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS Predict reactive species
Full Name: transmembrane and coiled-coil domains 1
Calculated Molecular Weight: 21 kDa
Observed Molecular Weight: 21 kDa
GenBank Accession Number: NM_019026
Gene Symbol: TMCO1
Gene ID (NCBI): 54499
RRID: AB_2880962
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UM00
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924