Proteintech, 27763-1-AP, RRAD Polyclonal antibody

Size: 20ul / 150ul The RRAD (27763-1-AP) by Proteintech is a Polyclonal antibody targeting RRAD in WB, ELISA applications with reactivity to human, mouse, rat samples 27763-1-AP targets RRAD in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, SKOV-3 cells, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information RRAD is also named as RAD1. RRAD, a member of the Ras-like small GTPase family, was initially identified as a gene associated with Type II diabetes since it was found to be overexpressed in some Type II diabetic patients (PMID: 8248782). RRAD overexpression reduced insulin-stimulated glucose uptake in cultured muscle and adipocytes cells (PMID: 8798502). RRAD was found to be frequently down-regulated in different types of human cancers, including lung cancer, breast cancer, and nasopharyngeal carcinoma, etc, due to the hypermethylation of its promoter (PMID: 17195088). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26869 Product name: Recombinant human RRAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-141 aa of BC057815 Sequence: SMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLM Predict reactive species Full Name: Ras-related associated with diabetes Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 29-34 kDa GenBank Accession Number: BC057815 Gene Symbol: RRAD Gene ID (NCBI): 6236 RRID: AB_3085993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55042 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.