Iright
BRAND / VENDOR: Proteintech

Proteintech, 27769-1-AP, TLR9 Polyclonal antibody

CATALOG NUMBER: 27769-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TLR9 (27769-1-AP) by Proteintech is a Polyclonal antibody targeting TLR9 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 27769-1-AP targets TLR9 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, Jurkat cells, Ramos cells, SH-SY5Y cells, mouse colon tissue, rat colon tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information TLR9 is a member of the Toll-like receptor family which has been described in a wide-variety of animal species. TLR9 recognizes DNA motifs containing the dinucleotide CG (cytosine-guanine) where the C is unmethylated (CpG-containing DNA). TLR9 is expressed in a wide variety of cells such as B-cells, eosinophils, neutrophils, dendritic cells, macrophages, bronchial epithelial cells, and type-I and type-II lung cells, amongst others. Like all TLRs that recognize nucleic acids, TLR9 is confined to the endoplasmic reticulum and to endolysosomes. Western blot analysis revealed a 130 kDa band (entire form). 100 kDa fragment (soluble form) and a supplementary 60~80 kDa band (cleaved fragment) (PMID: 24582318,18820679, 21604257). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25615 Product name: Recombinant human TLR9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 925-1032 aa of BC032713 Sequence: ASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE Predict reactive species Full Name: toll-like receptor 9 Calculated Molecular Weight: 1032 aa, 116 kDa Observed Molecular Weight: 100-130 kDa, 60-80 kDa GenBank Accession Number: BC032713 Gene Symbol: TLR9 Gene ID (NCBI): 54106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924