Iright
BRAND / VENDOR: Proteintech

Proteintech, 27770-1-AP, CD90 Polyclonal antibody

CATALOG NUMBER: 27770-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD90 (27770-1-AP) by Proteintech is a Polyclonal antibody targeting CD90 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 27770-1-AP targets CD90 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human brain tissue, mouse brain tissue, rat brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24713 Product name: Recombinant human CD90 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-130 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC Predict reactive species Full Name: Thy-1 cell surface antigen Calculated Molecular Weight: 161 aa, 18 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC065559 Gene Symbol: CD90/Thy1 Gene ID (NCBI): 7070 RRID: AB_3085994 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04216 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924