Proteintech, 27790-1-AP, C7orf43 Polyclonal antibody

Size: 20ul / 150ul The C7orf43 (27790-1-AP) by Proteintech is a Polyclonal antibody targeting C7orf43 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 27790-1-AP targets C7orf43 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The predicted MW of C7orf43 is 62 kDa. Catalog#27790-1-AP recognises 65-70 kDa band may due to phosphorylation. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27149 Product name: Recombinant human C7orf43 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 409-580 aa of BC015722 Sequence: EHAQAGKQLCEEERRAMQAALDSVVCHTPLNNLGFSRKGSALTFSVAFQALRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVEPVK Predict reactive species Full Name: chromosome 7 open reading frame 43 Observed Molecular Weight: 70 kDa GenBank Accession Number: BC015722 Gene Symbol: C7orf43 Gene ID (NCBI): 55262 RRID: AB_2880972 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.