Proteintech, 27791-1-AP, USP8 Polyclonal antibody

Size: 20ul / 150ul The USP8 (27791-1-AP) by Proteintech is a Polyclonal antibody targeting USP8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27791-1-AP targets USP8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information USP8 is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27143 Product name: Recombinant human USP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-253 aa of BC110590 Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV Predict reactive species Full Name: ubiquitin specific peptidase 8 Calculated Molecular Weight: 1118 aa, 128 kDa Observed Molecular Weight: 128 kDa GenBank Accession Number: BC110590 Gene Symbol: USP8 Gene ID (NCBI): 9101 RRID: AB_2880973 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40818 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.