Iright
BRAND / VENDOR: Proteintech

Proteintech, 27801-1-AP, SPG7 Polyclonal antibody

CATALOG NUMBER: 27801-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPG7 (27801-1-AP) by Proteintech is a Polyclonal antibody targeting SPG7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 27801-1-AP targets SPG7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SPG7 encodes a nuclear-encoded mitochondrial metalloprotease protein that is a member of the AAA protein family. Two transcript variants encoding distinct isoforms have been identified. The molecular weight of SPG7 is about 88-100 kDa (precursor),80 kDa (intermediate) and 70 kDa (mature)(PMID: 24767997), while the molecular weight of isoform 2 is about 54 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26265 Product name: Recombinant human SPG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC007692 Sequence: VATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVY Predict reactive species Full Name: spastic paraplegia 7 (pure and complicated autosomal recessive) Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 54 kDa, 70 kDa, 80kDa GenBank Accession Number: BC007692 Gene Symbol: SPG7 Gene ID (NCBI): 6687 RRID: AB_2918133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQ90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924