Proteintech, 27809-1-AP, pan-AKT Polyclonal antibody

Size: 20ul / 150ul The pan-AKT (27809-1-AP) by Proteintech is a Polyclonal antibody targeting pan-AKT in WB, ELISA applications with reactivity to human, mouse samples 27809-1-AP targets pan-AKT in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, HEK-293 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information AKT (also known as protein kinase B, PKB) is a serine threonine protein kinase consisting of three isoforms, AKT1, AKT2, and AKT3, which are encoded by three distinct genes, PKBα, PKBβ, and PKBγ, respectively. Among them, AKT1 is ubiquitously expressed and primarily regulates cell survival, AKT2 controls glucose metabolism, while AKT3 is highly expressed in the brain and testes. These isoforms are central nodes in the PI3K-AKT-mTOR signaling pathway, which is a critical regulator of cell survival, growth, proliferation, and metabolism (PMID: 25811375, PMID: 31173856, PMID: 36180910). This antibody detects total AKT1, AKT2, and AKT3 isoforms, typically showing a molecular weight of approximately 56-62 kDa in Western blot analysis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26642 Product name: Recombinant human AKT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 293-405 aa of BC000479 Sequence: FGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQH Predict reactive species Full Name: v-akt murine thymoma viral oncogene homolog 1 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56-62 kDa GenBank Accession Number: BC000479 Gene Symbol: AKT1 Gene ID (NCBI): 207 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.