Iright
BRAND / VENDOR: Proteintech

Proteintech, 27825-1-AP, MRP1 Polyclonal antibody

CATALOG NUMBER: 27825-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MRP1 (27825-1-AP) by Proteintech is a Polyclonal antibody targeting MRP1 in WB, IHC, ELISA applications with reactivity to Human samples 27825-1-AP targets MRP1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: 37°C incubated HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Multidrug resistant-associated protein 1 (MRP1, also known as ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1 Calculated Molecular Weight: 172 kDa Observed Molecular Weight: 180-190 kDa GenBank Accession Number: NM_004996 Gene Symbol: MRP1 Gene ID (NCBI): 4363 RRID: AB_3085997 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P33527 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924