Product Description
Size: 20ul / 150ul
The MRP1 (27825-1-AP) by Proteintech is a Polyclonal antibody targeting MRP1 in WB, IHC, ELISA applications with reactivity to Human samples
27825-1-AP targets MRP1 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: 37°C incubated HeLa cells
Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Multidrug resistant-associated protein 1 (MRP1, also known as ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier.
Specification
Tested Reactivity: Human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species
Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Calculated Molecular Weight: 172 kDa
Observed Molecular Weight: 180-190 kDa
GenBank Accession Number: NM_004996
Gene Symbol: MRP1
Gene ID (NCBI): 4363
RRID: AB_3085997
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P33527
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924