Proteintech, 27832-1-AP, MTSS1L Polyclonal antibody

Size: 20ul / 150ul The MTSS1L (27832-1-AP) by Proteintech is a Polyclonal antibody targeting MTSS1L in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 27832-1-AP targets MTSS1L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, U-251 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IP detected in: Jurkat cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MTSS2, also known as MTSS1L, contains a conserved N-terminal domain, called an IRSP53 /MIM homology domain (IMD) or inverse BAR domain, that is involved in plasma membrane dynamics (PMID: 20875796). MTSS2 potentiated PDGF-mediated formation of membrane ruffles and lamellipodia in fibroblasts, acting via RAC1 activation (PMID:14752106). MTSS2 is implicated in intellectual developmental disorders with ocular anomalies and distinctive facial features(PMID: 36067766). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27216 Product name: Recombinant human MTSS1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-246 aa of BC002770 Sequence: TFITFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDL Predict reactive species Full Name: metastasis suppressor 1-like Observed Molecular Weight: 68-70 kDa GenBank Accession Number: BC002770 Gene Symbol: MTSS1L Gene ID (NCBI): 92154 RRID: AB_2880986 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q765P7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.