Proteintech, 27843-1-AP, RPUSD4 Polyclonal antibody

Size: 20ul / 150ul The RPUSD4 (27843-1-AP) by Proteintech is a Polyclonal antibody targeting RPUSD4 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 27843-1-AP targets RPUSD4 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27225 Product name: Recombinant human RPUSD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-377 aa of BC014131 Sequence: HQDKNLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVPMPSAGVVDIPIVEKEAQGQQQHHKMTLSPSYRMDDGKMVKVRRSRNAQVAVTQYQVLSSTLSSALVELQPITGIKHQLRVHLSFGLDCPILGDHKYSDWNRLAPQKLSVGTLKKLGLEQSKARYIPLHLHARQLILPALGSGKEELNLVCKLPRFFVHSLHRLRLEMPNEDQNENNEAKCLGAQ Predict reactive species Full Name: RNA pseudouridylate synthase domain containing 4 Observed Molecular Weight: 39-42 kDa GenBank Accession Number: BC014131 Gene Symbol: RPUSD4 Gene ID (NCBI): 84881 RRID: AB_2880990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.