Iright
BRAND / VENDOR: Proteintech

Proteintech, 27845-1-AP, GDF-15 Polyclonal antibody

CATALOG NUMBER: 27845-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GDF-15 (27845-1-AP) by Proteintech is a Polyclonal antibody targeting GDF-15 in WB, IHC, ELISA applications with reactivity to human samples 27845-1-AP targets GDF-15 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, HepG2 cells, LNCaP cells, human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Growth differentiation factor 15 (GDF15), also known as macrophage inhibitory cytokine-1 (MIC-1), is a protein of the transforming growth factor beta (TGFb) superfamily that regulates inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF15 is a stress-induced cytokine and associated with hypoxia, inflammation and oxidative stress, it is also released from endothelial cells after stimulation with pro-inflammatory cytokines. GDF15 has been suggested as a target and biomarker for cardiovascular disease as it plays a cardioprotective role in the adult heart. GDF15 is highly expressed in the placenta. GDF15 is known to be involved in human embryo development and necessary for the maintenance of pregnancy. GDF15 is also produced by adipocytes in response to oxidative stress, a well-known factor associated with preeclampsia. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24090 Product name: Recombinant human GDF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC008962 Sequence: MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI Predict reactive species Full Name: growth differentiation factor 15 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC008962 Gene Symbol: GDF15 Gene ID (NCBI): 9518 RRID: AB_3669625 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99988 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924