Proteintech, 27871-1-AP, Endothelin 3 Polyclonal antibody

Size: 20ul / 150ul The Endothelin 3 (27871-1-AP) by Proteintech is a Polyclonal antibody targeting Endothelin 3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27871-1-AP targets Endothelin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue Positive IHC detected in: human thyroid cancer tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Endothelin 3 (EDN3) is also named as ET-3 and Preproendothelin-3 (PPET3). Endothelin 3 belongs to the endothelin/sarafotoxin family. It reported downregulation of EDN3 as a result of methylation of its promoter in breast cancer, and EDN3 level was also decreased in cervical cancer (PMID: 36542159). ET-3 is the most abundant ET peptide in the rat brain, mainly localized to neurons and glia of the neostriatum, hypothalamic nuclei, hippocampus, and Purkinje cells of the cerebellum and medulla oblongata (PMID: 32589590). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27393 Product name: Recombinant human EDN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-198 aa of BC053866 Sequence: SQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVE Predict reactive species Full Name: endothelin 3 Observed Molecular Weight: 28 kDa GenBank Accession Number: BC053866 Gene Symbol: Endothelin 3 Gene ID (NCBI): 1908 RRID: AB_3086000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14138 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.