Product Description
Size: 20ul / 150ul
The EGLN3 (27875-1-AP) by Proteintech is a Polyclonal antibody targeting EGLN3 in WB, IHC, ELISA applications with reactivity to human, mouse samples
27875-1-AP targets EGLN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: Jurkat cells
Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Background Information
EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27464 Product name: Recombinant human EGLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC010992 Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK Predict reactive species
Full Name: egl nine homolog 3 (C. elegans)
Calculated Molecular Weight: 27 kDa
Observed Molecular Weight: 27 kDa
GenBank Accession Number: BC010992
Gene Symbol: EGLN3
Gene ID (NCBI): 112399
RRID: AB_3086001
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9H6Z9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924