Proteintech, 27878-1-AP, FOXD3 Polyclonal antibody

Size: 20ul / 150ul The FOXD3 (27878-1-AP) by Proteintech is a Polyclonal antibody targeting FOXD3 in WB, ELISA applications with reactivity to Human samples 27878-1-AP targets FOXD3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information FOXD3, also named as HFH2, belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD3 binds to the consensus sequence 5'-A[AT]T[AG]TTTGTTT-3' and acts as a transcriptional repressor. It also acts as a transcriptional activator. FOXD3 promotes development of neural crest cells from neural tube progenitors. It restricts neural progenitor cells to the neural crest lineage while suppressing interneuron differentiation. It required for maintenance of pluripotent cells in the pre-implantation and peri-implantation stages of embryogenesis. FOXD3 has one isoform produced by alternative splicing with the MW of 47 kDa. It can be detected as 57-60 kDa in some literature(PMID: 31940493). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27260 Product name: Recombinant human FOXD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-138 aa of NM_012183.2 Sequence: MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGPGGDVGAPEADGCKGGVGGEEGGASGGGPGAGSGSAGGLAPSKPKNS Predict reactive species Full Name: forkhead box D3 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 57-60 kDa GenBank Accession Number: NM_012183.2 Gene Symbol: FOXD3 Gene ID (NCBI): 27022 RRID: AB_3086002 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.