Proteintech, 27900-1-AP, MERTK Polyclonal antibody

Size: 20ul / 150ul The MERTK (27900-1-AP) by Proteintech is a Polyclonal antibody targeting MERTK in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 27900-1-AP targets MERTK in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, U-937 cells, mouse testis tissue, Jurkat cells Positive IHC detected in: rat liver tissue, human lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat liver tissue Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MerTK (Mer tyrosine kinase), also known as RP38, c-Eyk, c-mer, and Tyro12, was first cloned from a human B lymphoblastoid expression library (PMID:8086340) and is one of the TAM (Tyro-3, Axl, and MerTK) receptor tyrosine kinase (RTK) family (PMID:23833304). Although this RTK, like others, can promote tumor cell proliferation to some extent, MERTK primarily lends tumor cells crucial survival advantages while promoting invasion, migration and metastasis, drug resistance, and, in the innate immune system, suppressing anti-tumor immunity (PMID:32417270). The multiple MERTK species observed are likely due to posttranslational modifications (PMID: 23585477). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27540 Product name: Recombinant human MERTK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 829-999 aa of BC114918 Sequence: ELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM Predict reactive species Full Name: c-mer proto-oncogene tyrosine kinase Calculated Molecular Weight: 999 aa, 110 kDa Observed Molecular Weight: 150-180 kDa GenBank Accession Number: BC114918 Gene Symbol: MERTK Gene ID (NCBI): 10461 RRID: AB_3086006 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12866 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.