Iright
BRAND / VENDOR: Proteintech

Proteintech, 27904-1-AP, BORG5/CDC42EP1 Polyclonal antibody

CATALOG NUMBER: 27904-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BORG5/CDC42EP1 (27904-1-AP) by Proteintech is a Polyclonal antibody targeting BORG5/CDC42EP1 in WB, ELISA applications with reactivity to human samples 27904-1-AP targets BORG5/CDC42EP1 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, K-562 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CDC42EP1, also known as BORG5, is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. BORG5 was discovered as a 55 kDa protein, but the accepted reference protein is only 40.3 kDa. Specification Tested Reactivity: human Cited Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27396 Product name: Recombinant human CDC42EP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-391 aa of BC009356 Sequence: RLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV Predict reactive species Full Name: CDC42 effector protein (Rho GTPase binding) 1 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC009356 Gene Symbol: CDC42EP1 Gene ID (NCBI): 11135 RRID: AB_3086008 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00587 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924