Proteintech, 27905-1-AP, SH3TC2 Polyclonal antibody

Size: 20ul / 150ul The SH3TC2 (27905-1-AP) by Proteintech is a Polyclonal antibody targeting SH3TC2 in IHC, IF/ICC, ELISA applications with reactivity to human samples 27905-1-AP targets SH3TC2 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The SH3TC2 protein (also known as KIAA1985 protein) is an adaptor protein involved in myelin formation in the peripheral nervous system. This protein contains multiple functional domains, including the SH3 (Src homology 3) and TPR (tetratricopeptide repeat) domains, which mediate protein-protein interactions. It is highly expressed in Schwann cells and is crucial for maintaining the stability of myelin structure. Clinically, mutations in the SH3TC2 gene are associated with Charcot-Marie-Tooth disease type 4C (CMT4C), an autosomal recessive peripheral neuropathy characterized by progressive demyelination of motor and sensory nerves, limb weakness, and loss of sensation. Studies have shown that the absence or dysfunction of SH3TC2 protein can lead to disordered signaling pathways in Schwann cells (such as Rab11-mediated membrane transport defects), affecting myelin development and repair. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27352 Product name: Recombinant human SH3TC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-467 aa of BC113879 Sequence: CGLSRKRDWTGSYQIGRGRCKALTGYEPGEKDELNFYQGESIEIIGFVIPGLQWFIGKSTSSGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQPEGFKEVRPGRAWEEHQAVGSRQSSSSEDSSLEEELLSATSDSYRLPEPDDLDDPELLMDLSTGQEEEAENF Predict reactive species Full Name: SH3 domain and tetratricopeptide repeats 2 Calculated Molecular Weight: 1288 aa, 145 kDa GenBank Accession Number: BC113879 Gene Symbol: SH3TC2 Gene ID (NCBI): 79628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TF17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.