Iright
BRAND / VENDOR: Proteintech

Proteintech, 27929-1-AP, GABRA5 Polyclonal antibody

CATALOG NUMBER: 27929-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GABRA5 (27929-1-AP) by Proteintech is a Polyclonal antibody targeting GABRA5 in WB, IHC, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 27929-1-AP targets GABRA5 in WB, IHC, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27376 Product name: Recombinant human GABRA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-222 aa of BC113422 Sequence: SSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRL Predict reactive species Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 5 Calculated Molecular Weight: 462 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC113422 Gene Symbol: GABRA5 Gene ID (NCBI): 2558 RRID: AB_2923580 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31644 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924