Proteintech, 27935-1-AP, WNT1 Polyclonal antibody

Size: 20ul / 150ul The WNT1 (27935-1-AP) by Proteintech is a Polyclonal antibody targeting WNT1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 27935-1-AP targets WNT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 3T3-L1 cells, HepG2 cells, NIH/3T3 cells, Jurkat cells Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27380 Product name: Recombinant human WNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 228-323 aa of BC074799 Sequence: TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD Predict reactive species Full Name: wingless-type MMTV integration site family, member 1 Observed Molecular Weight: 41 kDa GenBank Accession Number: BC074799 Gene Symbol: WNT1 Gene ID (NCBI): 7471 RRID: AB_2881013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04628 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.