Proteintech, 27948-1-AP, UTRN Polyclonal antibody

Size: 20ul / 150ul The UTRN (27948-1-AP) by Proteintech is a Polyclonal antibody targeting UTRN in WB, IHC, ELISA applications with reactivity to Human samples 27948-1-AP targets UTRN in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Utrophin is a large protein (395 kDa) which is widely expressed and most abundant in several non-skeletal muscle tissues, for example lung, intestine, embryonic neural tube, sensory ganglia, tendons and ossifying cartilages. Two alternate intronic transcripts of utrophin have been described: Up71 and Up140. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27497 Product name: Recombinant human UTRN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-932 aa of NM_007124 Sequence: MQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHLENELKGQPGHAYLETLKTLKDVLNDSENKAQV Predict reactive species Full Name: utrophin Calculated Molecular Weight: 395 kDa Observed Molecular Weight: 394 kDa, 70 kDa GenBank Accession Number: NM_007124 Gene Symbol: UTRN Gene ID (NCBI): 7402 RRID: AB_2881018 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46939 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.